Protein Info for BWI76_RS21575 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF10604: Polyketide_cyc2" amino acids 14 to 145 (132 residues), 36.2 bits, see alignment E=7.4e-13 PF03364: Polyketide_cyc" amino acids 23 to 148 (126 residues), 126.3 bits, see alignment E=9.1e-41

Best Hits

Swiss-Prot: 85% identical to RATA_ECOLI: Ribosome association toxin RatA (ratA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to kpu:KP1_4197)

Predicted SEED Role

"Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXA3 at UniProt or InterPro

Protein Sequence (158 amino acids)

>BWI76_RS21575 hypothetical protein (Klebsiella michiganensis M5al)
MILFAPCLYVEPAMPQISRTALVPFSAEQMYQLVNDVKSYPDFLPGCTGSRVLELGPTQM
TAAVDVSKAGISKTFTTRNTLTSNQSILMSLVDGPFKKLIGGWKFIPLSPEACKIEFHLD
FEFTNKLIEMAFGRIFKELAMNMVQAFTTRAKEVYSAG