Protein Info for BWI76_RS21535 in Klebsiella michiganensis M5al

Annotation: inner membrane protein YpjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01578: Cytochrom_C_asm
  • amino acids 36 to 262 (227 residues), 162 bits, E=8.1e-52

Best Hits

Swiss-Prot: 90% identical to YPJD_ECO57: Inner membrane protein YpjD (ypjD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to kva:Kvar_1132)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See A0A285AX71 at UniProt or InterPro

Protein Sequence (263 amino acids)

>BWI76_RS21535 inner membrane protein YpjD (Klebsiella michiganensis M5al)
MPVFALLALVAYSISLALIVPGLLQKNSSWRRMAILSATIALICHAFALESRIFPGGESG
QNLSLLNVGSLVSLMICTVMTIVASRNRGWLLLPIVYTFALINLAFATFMPNEYITHLET
TPGMLVHIGLSLFSYATLIIAALYALQLAWIDYQLKNKKLTFSSEMPPLMSIERKMFHIT
QIGVVLLTLTLCTGLFYMHNLFSAENIDKAVLSIIAWFVYIVLLWGHYHEGWRGRRVVWF
NVTGAGLLTLAYFGSRVLQQFMS