Protein Info for BWI76_RS21515 in Klebsiella michiganensis M5al

Annotation: tRNA (guanosine(37)-N1)-methyltransferase TrmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 98% identical to TRMD_ESCF3: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 97% identity to eco:b2607)

MetaCyc: 97% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

7-(3-amino-3-carboxypropyl)-wyosine biosynthesis (1/4 steps found)
methylwyosine biosynthesis (1/4 steps found)
wybutosine biosynthesis (1/6 steps found)
tRNA methylation (yeast) (1/16 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX57 at UniProt or InterPro

Protein Sequence (255 amino acids)

>BWI76_RS21515 tRNA (guanosine(37)-N1)-methyltransferase TrmD (Klebsiella michiganensis M5al)
MFIGIVSLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFAHDRHRTVDDRPYGGGPGM
LMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGVDE
RVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASAIEDSFAEGLLDCPH
YTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEF
KKELAQQQHKHDGMA