Protein Info for BWI76_RS21410 in Klebsiella michiganensis M5al

Annotation: lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF10043: DUF2279" amino acids 25 to 101 (77 residues), 40.1 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 83% identical to YFIM_ECOLI: Uncharacterized protein YfiM (yfiM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_01015)

Predicted SEED Role

"Putative outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7K9 at UniProt or InterPro

Protein Sequence (108 amino acids)

>BWI76_RS21410 lipoprotein (Klebsiella michiganensis M5al)
MRVIMLIVPLLLLTGCSHMANDAWSGQDKAQHFLASAMLSAAGNEYAQHQGYSRDRSAAI
GFMFSVSLGASKELWDSRPSGSGWSWKDFAWDVAGATTGYAVWQLAHQ