Protein Info for BWI76_RS21365 in Klebsiella michiganensis M5al

Annotation: tRNA (adenosine(37)-N6)-methyltransferase TrmM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF01135: PCMT" amino acids 42 to 107 (66 residues), 24.6 bits, see alignment E=8.1e-09 PF06325: PrmA" amino acids 44 to 122 (79 residues), 28.6 bits, see alignment E=4.1e-10 PF05175: MTS" amino acids 44 to 128 (85 residues), 51 bits, see alignment E=5.4e-17 PF13847: Methyltransf_31" amino acids 46 to 132 (87 residues), 31.2 bits, see alignment E=6.5e-11 PF00398: RrnaAD" amino acids 46 to 122 (77 residues), 24.1 bits, see alignment E=7.5e-09 PF13649: Methyltransf_25" amino acids 48 to 122 (75 residues), 40.2 bits, see alignment E=1.8e-13 PF08241: Methyltransf_11" amino acids 49 to 121 (73 residues), 24.7 bits, see alignment E=1.2e-08 PF01170: UPF0020" amino acids 68 to 125 (58 residues), 23.8 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 87% identical to TRMN6_KLEP7: tRNA1(Val) (adenine(37)-N6)-methyltransferase (KPN78578_28490) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 87% identity to kpn:KPN_02900)

MetaCyc: 75% identical to tRNA m6A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12480 [EC: 2.1.1.223]

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7W7 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS21365 tRNA (adenosine(37)-N6)-methyltransferase TrmM (Klebsiella michiganensis M5al)
MSQSKFALPRNGFTFKQFFVAHDRCAMKVGTDGILLGAWAPIAQVKRVLDIGAGSGLLAL
MLAQRTGETVIVDAVELDEEAAAQAQENAADSPWAGRLQIHQADIQQWQPPQTRRYELIV
SNPPFFADGVPCATSQREQARYTSSLDHATLLTCAAELITEEGFFCVVLPVDIGNAFVQR
AQNMGWHLRLRTDVAETEMRPPHRVLLAFSPTPGDECFSDRLIIRGPEQQYSEGFTALTQ
DFYLFM