Protein Info for BWI76_RS21345 in Klebsiella michiganensis M5al

Annotation: sigma-E factor regulatory protein RseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03888: MucB_RseB" amino acids 28 to 207 (180 residues), 203.1 bits, see alignment E=2.7e-64 PF17188: MucB_RseB_C" amino acids 218 to 313 (96 residues), 94.6 bits, see alignment E=3.3e-31

Best Hits

Swiss-Prot: 81% identical to RSEB_SALT1: Sigma-E factor regulatory protein RseB (rseB) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_00950)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7H5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>BWI76_RS21345 sigma-E factor regulatory protein RseB (Klebsiella michiganensis M5al)
MKQLWCAMSLMAGSLFFSVNASADTSSGALLQQMNLASQSLNYELSFVSINKQGVESLRY
RHAKLDNRTLAQLLQLDGPRREVVLRGTEISYFEPGLDPFTLNGDYIVDSLPSLVYSDFK
RLASYYDFISVGRTRIADRLCDVVRVVARDGTRYSYIAWLDAETKLPLRVDLLDRDGETL
EQFRVVSFNVGDNVSASMETLSKANLPPQLSVPEGGNKANFNWAPTWLPQGVAEVSSSQR
RLPTFDGPVESRLYSDGLFSFSININRATANSSDQLLRTGRRTVATTVRDNAEITIVGEL
PPQTAKRISDSIKFRAVQ