Protein Info for BWI76_RS21330 in Klebsiella michiganensis M5al

Annotation: S26 family signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 61 to 81 (21 residues), see Phobius details PF10502: Peptidase_S26" amino acids 61 to 301 (241 residues), 170.9 bits, see alignment E=1.2e-54 TIGR02227: signal peptidase I" amino acids 66 to 159 (94 residues), 85.9 bits, see alignment E=1.4e-28 amino acids 262 to 304 (43 residues), 59.2 bits, see alignment 2.3e-20

Best Hits

Swiss-Prot: 90% identical to LEP_ECOLI: Signal peptidase I (lepB) from Escherichia coli (strain K12)

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 97% identity to kpu:KP1_4148)

MetaCyc: 90% identical to signal peptidase I (Escherichia coli K-12 substr. MG1655)
Signal peptidase I. [EC: 3.4.21.89]

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7I1 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BWI76_RS21330 S26 family signal peptidase (Klebsiella michiganensis M5al)
MANMFALILVIATLVTGLLWCLDKFIFAPKRRESQAAAQAATGDQLDKKTLKKVGPKPGW
LETGASVFPVLAIVLVVRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTL
IETGHPKRGDIVVFKYPQDPRLDYIKRAVGLPGDKVTYDPIAKQVTIQPGCSSGQACGNA
LPVTYSNVEPSDFVQTFSRSNGGEATSGFWQLPKGETKADGIRLTERKETLGEVTHRILT
VPIAQDQVGMYYHQSGLPLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGKATAI
WMSFEKQEGEWPTGVRLSRIGGIQ