Protein Info for BWI76_RS21290 in Klebsiella michiganensis M5al

Annotation: DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF01418: HTH_6" amino acids 1 to 76 (76 residues), 97.9 bits, see alignment E=2.7e-32 PF01380: SIS" amino acids 129 to 257 (129 residues), 96.2 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 78% identical to YFHH_ECOLI: Uncharacterized HTH-type transcriptional regulator YfhH (yfhH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to kpu:KP1_4140)

Predicted SEED Role

"Sialic acid utilization regulator, RpiR family" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B850 at UniProt or InterPro

Protein Sequence (282 amino acids)

>BWI76_RS21290 DNA-binding transcriptional regulator (Klebsiella michiganensis M5al)
MNCLTRIRQRYPTLAASDKKLADFILAQPDQTRHLSSQQLAGEAGVSQSSVVKFAQKMGF
KGFPALKLALSEALASAPTPQSVPVHNQIRGDDPLRLVGEKLIKDNIAAMHASLDVNTEE
KLLEAVTLLRHARRVIITGIGASGLVARNFSWKLMKIGINAVSEQDMHALLATVQAMSPD
DLLLAISYSGERREINMAAGEALRVGSQILALTGFNPNALQQQATLCLYTIAEEQATRSA
AISSTSAQMMLTDLLFMGLVQQDLEHAPERIRHSEALVKKLV