Protein Info for BWI76_RS21280 in Klebsiella michiganensis M5al

Annotation: tRNA adenosine(34) deaminase TadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14437: MafB19-deam
  • amino acids 20 to 166 (147 residues), 141 bits, E=2.4e-45
• PF00383: dCMP_cyt_deam_1
  • amino acids 20 to 118 (99 residues), 107.7 bits, E=2.6e-35

Best Hits

Swiss-Prot: 85% identical to TADA_SHIFL: tRNA-specific adenosine deaminase (tadA) from Shigella flexneri

KEGG orthology group: K11991, tRNA-specific adenosine deaminase [EC: 3.5.4.-] (inferred from 92% identity to kpu:KP1_4138)

MetaCyc: 85% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

See A0A285B7H2 at UniProt or InterPro

Protein Sequence (181 amino acids)

>BWI76_RS21280 tRNA adenosine(34) deaminase TadA (Klebsiella michiganensis M5al)
MYNAPRFSAGVPALSDHELNDEYWMRHALTLAKRAWEEGEVPVGAVLVHNHQVIGEGWNR
PIGRHDPTAHAEIMALRQGGLVLQNYRLIDATLYVTLEPCVMCAGAMVHSRISRLVFGAR
DAKTGAAGSLMDVLHHPGMNHRVEITEGIMAEACSGMLSDFFRWRREEKKALKRAGQQVQ
D