Protein Info for BWI76_RS21275 in Klebsiella michiganensis M5al

Annotation: lytic transglycosylase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 77 to 295 (219 residues), 79.7 bits, see alignment E=1.7e-26 PF01464: SLT" amino acids 324 to 430 (107 residues), 81.3 bits, see alignment E=4.1e-27

Best Hits

Swiss-Prot: 85% identical to MLTF_KLEP7: Membrane-bound lytic murein transglycosylase F (mltF) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 86% identity to kpe:KPK_1238)

MetaCyc: 76% identical to membrane-bound lytic murein transglycosylase F (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Transglycosylase, Slt family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7P9 at UniProt or InterPro

Protein Sequence (538 amino acids)

>BWI76_RS21275 lytic transglycosylase F (Klebsiella michiganensis M5al)
MPLNPRQPFTFSGHNLLRNPKLQKINYLKKLKINYLLIGIVTLLLAAALWPSLPWMGKPE
NRVAGIMARGELRISTINSPMTFATLNDKTYGFDYELAQQFADYLGVELKVTVRQNISQL
FDDLDEGKADMLAAGLVYNSERVKNYQVGPTYYSVSQQLVYRKGNLRPRTLANLTAAQLA
IAPGHVAINDLQALKEQKYPDLDWRVDDKRGTTALMQAVIDGKLDYTVADSVAVSLFQRV
HPELAVALDISDEQPVTWFSEKGEDNSLSAAMLDFFNNINEDGTLARLEEKYLGHGNDFD
YVDTRTFLRAVESVLPDLQPMFEKYARQIDWRLLAAISWQESHWDPQATSPTGVRGIMML
TRNTAQSLGLTDRTDAEQSIDGGMRYLQDMMNKVPESVPQDERIWFALAAYNMGYAHMLD
AMALTKKQKGDPNSWADVKQRLPLLSQKNYYSRLKYGFARGHEAYAYVENIRKYHISLVG
YLSEKERKEAQMAALGEHYPAVMPDELDKPEQYASSFFNFRAETLVDNAKLKIPGAGH