Protein Info for BWI76_RS21260 in Klebsiella michiganensis M5al

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details PF00512: HisKA" amino acids 256 to 322 (67 residues), 62.5 bits, see alignment E=3.1e-21 PF02518: HATPase_c" amino acids 368 to 477 (110 residues), 77.1 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 78% identical to GLRK_ECOLI: Sensor histidine kinase GlrK (glrK) from Escherichia coli (strain K12)

KEGG orthology group: K07711, two-component system, NtrC family, sensor histidine kinase YfhK [EC: 2.7.13.3] (inferred from 91% identity to kpe:KPK_1241)

MetaCyc: 78% identical to histidine kinase GlrK (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7U7 at UniProt or InterPro

Protein Sequence (484 amino acids)

>BWI76_RS21260 two-component sensor histidine kinase (Klebsiella michiganensis M5al)
MIETLSLKRLSLFPRSLRQLVTLSFVLILLPLLVLAWQAWQSLNALSAQAAHINRTTLID
ARRSEAMINASLEMERSYRQYCVLDDPTLARVYQNQRQRYSEMLDAHAGVLPDEKIWRAL
RQDLDDLAELQCKNSGPAAKSAASLEAFASANSDMVQATRTVVYSRGQQLQQEIAERGQF
FGWQALVLFLLSLALVLLFTRMIIGPVKGIERMINRLGEGKSLDDAALFTGPRELRSVGK
RIIWLSERLAWLESQRHQFLRHLSHELKTPLASMREGTELLADRVAGPLTPEQQEIVEIL
DNSSRNLQKLIEQLLDYNRKQADGPIARETVNLAELVENVVSAHSLPARAKMMHTELALS
ERFCEAEPALLVSVLDNLYSNAVHYGAESGNIRIHSYRHGEQVRIDVINNGEPIPPAERN
MIFEPFYQGSHQRKGAVKGSGLGLSIARDCVRQMQGELSLVDDKSGLICFRITLPVAESG
KNNV