Protein Info for BWI76_RS21215 in Klebsiella michiganensis M5al

Annotation: NAGC-like transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF13412: HTH_24" amino acids 20 to 58 (39 residues), 23 bits, see alignment 4.8e-09 PF00480: ROK" amino acids 92 to 341 (250 residues), 115.7 bits, see alignment E=3.1e-37

Best Hits

Swiss-Prot: 66% identical to YPHH_ECOLI: Uncharacterized protein YphH (yphH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to kpn:KPN_02874)

Predicted SEED Role

"Putative NAGC-like transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7N9 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BWI76_RS21215 NAGC-like transcriptional regulator (Klebsiella michiganensis M5al)
MQRTGLNNARVRQTNKSIFLAHLWREKQLSKSQLSQLTGLSIPAVSNILEELLSEGLIDH
STEKMSKRGMNSGSYQIPARGAWTLCMNITPTSIEYQLADARLLAVDGCQHVPIDAPTPQ
ALLESIIACWRRIHRLYPQHSIHLALGVHGQVDPITGVSQTMPQARWKTPIEIKYLLEEQ
LGVQVRVDNDCVMLALAEKWQHQGPQPDFCVINVDYGIGSSFVINDQIYRGSLYGSGQIG
HTIVNPDGKACDCGRYGCLETVASLSALKKQARMWLKTQPEAQRSPEQLTTASLIEAWEK
GDVHIRAWVDSAANAIGLSLYNFLNILNINQIWLYGRSCAFGEQWLESIVKQTGFNPFDH
GDTPRAHATQIGFGTLTRAQQLMGIGYLYVEEQLQTLR