Protein Info for BWI76_RS21205 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 5 to 457 (453 residues), 359.2 bits, see alignment E=1.7e-111 PF00083: Sugar_tr" amino acids 17 to 460 (444 residues), 370.6 bits, see alignment E=1.2e-114 PF07690: MFS_1" amino acids 21 to 280 (260 residues), 76.9 bits, see alignment E=1.4e-25 amino acids 272 to 454 (183 residues), 39.3 bits, see alignment E=4e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to kpu:KP1_4124)

Predicted SEED Role

"sugar-proton symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7T7 at UniProt or InterPro

Protein Sequence (478 amino acids)

>BWI76_RS21205 MFS transporter (Klebsiella michiganensis M5al)
MNNAQTHLKMGYVWTICLVAACGGLLFGYDWVVIGGAKPFYEAWFSITDPAQSGWAMSSA
LVGCVFGALISGWCADKLGRKLPLILSAVLFSASAWGTAVASSFDMFVVYRIVGGVGIGL
ASALSPLYIAEVSPAEKRGRFVAVNQLTIVIGVLAAQLINLMIAEPVATGATQQMIVETW
NGQMGWRWMFGAELVPALAFLVLMFFVPESPRWLMKAGKPERARAALERIGSADYADRIL
RDIAHTLEKDNHKVSYGALLAPQVKPIVIIGMVLAVFQQWCGINVIFNYAQEIFASAGFD
INSTLKSIVATGVVNLVFTLAALPLVDKIGRRKLMLLGASGLTLIYVLIAGAYAMGIMGW
PVLLLVLAAIAIYALTLAPVTWVLLAEIFPNRVRGLAMSLGTLALWIACFLLTYTFPLLN
AGLGAAGSFLLYGVICAAGYLYILRNVPETKGVTLEALEEQLAQRHTGVNAAKQEQTR