Protein Info for BWI76_RS21165 in Klebsiella michiganensis M5al

Annotation: Fe-S cluster assembly transcriptional regulator IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 155.3 bits, see alignment E=8e-50 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 219 bits, see alignment E=1.7e-69 PF02082: Rrf2" amino acids 3 to 132 (130 residues), 131.6 bits, see alignment E=1e-42

Best Hits

Swiss-Prot: 96% identical to ISCR_KLEP7: HTH-type transcriptional regulator IscR (iscR) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_00790)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7N3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>BWI76_RS21165 Fe-S cluster assembly transcriptional regulator IscR (Klebsiella michiganensis M5al)
MRLTSKGRYAVTAMLDVALNSESGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRG
PGGGYLLGKEAGSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSERLTGF
LNNITLGELVNNQEILDVSGRQHNHESQRNTRAQDAIDVKLRA