Protein Info for BWI76_RS21155 in Klebsiella michiganensis M5al

Annotation: iron-sulfur cluster scaffold-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01592: NifU_N
  • amino acids 2 to 126 (125 residues), 184.5 bits, E=4e-59
• TIGR01999: FeS cluster assembly scaffold IscU
  • amino acids 3 to 126 (124 residues), 235.9 bits, E=4.4e-75

Best Hits

Swiss-Prot: 98% identical to ISCU_ECOL6: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 98% identity to ece:Z3796)

MetaCyc: 98% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)

Sequence Analysis Tools

See A0A285B7T0 at UniProt or InterPro

Protein Sequence (128 amino acids)

>BWI76_RS21155 iron-sulfur cluster scaffold-like protein (Klebsiella michiganensis M5al)
MAYSEKVIDHYENPRNVGSFDNSDENVGSGMVGAPACGDVMKLQIKVNNEGIIEDARFKT
YGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKIHCSILAEDAIKAAIAD
YKSKREAK