Protein Info for BWI76_RS21095 in Klebsiella michiganensis M5al

Annotation: bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 18 to 373 (356 residues), 581.3 bits, see alignment E=3.1e-179 PF21016: RlmN_N" amino acids 22 to 81 (60 residues), 108.9 bits, see alignment E=8.1e-36 PF04055: Radical_SAM" amino acids 124 to 298 (175 residues), 57.6 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 98% identical to RLMN_KLEP3: Dual-specificity RNA methyltransferase RlmN (rlmN) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 98% identity to kpn:KPN_02847)

MetaCyc: 93% identical to 23S rRNA m2A2503 methyltransferase/tRNA m2A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11586 [EC: 2.1.1.192]; 2.1.1.- [EC: 2.1.1.192]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.192

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7S2 at UniProt or InterPro

Protein Sequence (388 amino acids)

>BWI76_RS21095 bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN (Klebsiella michiganensis M5al)
MSEQIVTPDSAALTVPNKDAKINLLDLNRQQLREFFKNMGEKPFRADQVMKWMYHYCCDN
FDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVGDQRVETVYIPEDDRAT
LCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAVKTTGVRPITNVVMM
GMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDMIDVALAISLHA
PNDTIRDEIVPINKKYNIETFLNSVRGYISKSNANQGRVTIEYVMLDHVNDGTEHAHELA
ALLKDTPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMEYGFTTIVRKTRGDDIDAACG
QLAGDVIDRTKRTLRKRMQGEAIDVKAV