Protein Info for BWI76_RS21085 in Klebsiella michiganensis M5al

Annotation: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00612: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase" amino acids 9 to 350 (342 residues), 418.6 bits, see alignment E=1.1e-129 PF04551: GcpE" amino acids 13 to 353 (341 residues), 480.8 bits, see alignment E=1.1e-148

Best Hits

Swiss-Prot: 99% identical to ISPG_KLEP7: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (ispG) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03526, (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC: 1.17.7.1] (inferred from 98% identity to kva:Kvar_1213)

MetaCyc: 98% identical to (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) (Escherichia coli K-12 substr. MG1655)
RXN-15878 [EC: 1.17.7.3]

Predicted SEED Role

"1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1)" in subsystem Isoprenoid Biosynthesis (EC 1.17.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.7.1 or 1.17.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7D2 at UniProt or InterPro

Protein Sequence (373 amino acids)

>BWI76_RS21085 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (Klebsiella michiganensis M5al)
MHNQAPIQRRKSKRIYVGNVPIGDGAPIAVQSMTNTRTTDVAATVNQIKALERVGADIVR
VSVPTMDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRM
VVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMRHVDHLDRLNFDQFKVSV
KASDVFLAVESYRLLAKQIDQPLHLGITEAGGARSGAVKSAIGLGLLLSEGIGDTLRVSL
AADPVEEIKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNALEQRLEDIITPMDI
SIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLDNDDMIDQLEARIRAKASMLD
EARRIDIQQVEAK