Protein Info for BWI76_RS21035 in Klebsiella michiganensis M5al

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF13742: tRNA_anti_2" amino acids 10 to 103 (94 residues), 117.6 bits, see alignment E=3.5e-38 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 11 to 358 (348 residues), 471.5 bits, see alignment E=1.2e-145 PF01336: tRNA_anti-codon" amino acids 30 to 104 (75 residues), 48.7 bits, see alignment E=9.2e-17 PF02601: Exonuc_VII_L" amino acids 126 to 440 (315 residues), 389.9 bits, see alignment E=1.6e-120

Best Hits

Swiss-Prot: 90% identical to EX7L_KLEP3: Exodeoxyribonuclease 7 large subunit (xseA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_00670)

MetaCyc: 86% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7B5 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BWI76_RS21035 exodeoxyribonuclease VII large subunit (Klebsiella michiganensis M5al)
MLPSQSPSIYTVSRLNQSVRLLLEREMGQVWISGEISNFNQPSSGHWYFTLKDDNAQVRC
AMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAA
LAAEGLFDQQHKKALPSPAHCIGVITSKTGAALHDILHVLKRRDPSLPVVIYPTAVQGED
APGQIVRAIELANARHECDVLIVGRGGGSLEDLWSFNDERVARAIFASPIPIVSAVGHET
DVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLANRHRRFTQIF
HRLQQQHPQLRLARQQTELERLRQRMRFALETQMKRADQRQQRAAQRLNQQNPQPRIHRA
QSRIQQLEYRLAENIRARLGDQRERFGNMVTHLEAVSPLATLARGYSVTSVSDGKVLKQT
TQVREGDLLTTRLNDGWVESEVKNITPVKKTRTRKKA