Protein Info for BWI76_RS21030 in Klebsiella michiganensis M5al

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 8 to 454 (447 residues), 656.5 bits, E=1.1e-201
• PF00478: IMPDH
  • amino acids 8 to 473 (466 residues), 540.7 bits, E=2.7e-166
• PF00571: CBS
  • amino acids 95 to 140 (46 residues), 36.8 bits, 8.4e-13
  • amino acids 153 to 204 (52 residues), 27.9 bits, 5e-10
• PF01070: FMN_dh
  • amino acids 278 to 362 (85 residues), 30.6 bits, E=3.7e-11

Best Hits

Swiss-Prot: 97% identical to IMDH_ECO57: Inosine-5'-monophosphate dehydrogenase (guaB) from Escherichia coli O157:H7

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 97% identity to eco:b2508)

MetaCyc: 97% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• purine nucleotides degradation II (aerobic) (11/11 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of purines degradation in plants (15/18 steps found)
• ureide biosynthesis (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See A0A285B801 at UniProt or InterPro

Protein Sequence (488 amino acids)

>BWI76_RS21030 IMP dehydrogenase (Klebsiella michiganensis M5al)
MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIA
LAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKVLTERNGFAG
YPVVTEDNELVGIITGRDVRFVTDLNQPVSVYMTPKERLVTVREGESREVVFAKMHEKRV
EKALVVDDSFHLLGMITVKDFQKAERKPNACKDEQGRLRVGAAVGAGAGNEERVDALVAA
GVDILLIDSSHGHSEGVLQRIRDTRAKYPDLQIIGGNVATGAGARALAEAGCSAVKVGIG
PGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKAIAAGAAAVMV
GSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQTDNAADKLVPEGIEGR
VAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDTLRTKAEFVRISGAGIQESHVHDVTITKE
SPNYRMGS