Protein Info for BWI76_RS21020 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 237 to 254 (18 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 313 (286 residues), 69.1 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: None (inferred from 72% identity to eae:EAE_00645)

Predicted SEED Role

"FIG00732137: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7B8 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BWI76_RS21020 MFS transporter (Klebsiella michiganensis M5al)
MDTPTKSLSAPGFVTLAAGCNQLINWGISFYMPGTFARAIAHETGWAATEIYFGLTIAML
MMAMLSPFVARLLAHFGGQRIVVTGTLMISAGCLIMAYVHSLSAWFAAWALTGVGMRLAL
YDALFAALVNSYGQSARLTISRVTLAGGLASALFWPLGAGLLTQMNWRHALLIYALFGLL
SAMLLWKMPNHKLPSPRRTIKRQRLSGRDKRSALLYASLIALVTFVSNGTSTHLPEFIAS
VGLPVAVGMLWGIGQTGARFLEVASGSALTPLRLTLLTTLVMPLCFALGLSGSYLSWAAG
GFVLGYGAINGLTTVFKATLPLQLFAAKDYARRTGILLIPAQLLAAASPFVYAWLNHHLG
MRGSLAVSAALALVVFGLAMSIAWDHREKTPAEIEERG