Protein Info for BWI76_RS21005 in Klebsiella michiganensis M5al

Annotation: sensor domain-containing phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 44 to 73 (30 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details PF05231: MASE1" amino acids 15 to 320 (306 residues), 139.7 bits, see alignment E=1.1e-44 PF00563: EAL" amino acids 498 to 730 (233 residues), 227.5 bits, see alignment E=1.6e-71

Best Hits

Swiss-Prot: 59% identical to PDEF_ECOLI: Cyclic di-GMP phosphodiesterase PdeF (pdeF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 75% identity to eae:EAE_00630)

MetaCyc: 59% identical to cyclic di-GMP phosphodiesterase PdeF (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"Putative cytochrome C-type biogenesis protein" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7P5 at UniProt or InterPro

Protein Sequence (740 amino acids)

>BWI76_RS21005 sensor domain-containing phosphodiesterase (Klebsiella michiganensis M5al)
MKIIKLYRQYRDKWWALPLILPVLLLPLARWANTDALLDGNEVYLYYLPLALVLSLMLFF
GWTALPGIVLGLLLTITRGMTLEDSIGVIFHFLIPTVLSWGGYRVFVPRRQQISHGNVRL
MPQRLVWQMLLPSLIFLVLSQLAEYLGIHPRATGLIGVNPLSLRSLITFQALMAGCLTGV
PLCYFLIRIIRNPLYIRGFVSQIRLQIDPKIKRLEFILWAAVLIILLVLLLMPLNSTSTI
FSTNYTLSLLMPVMLWGAMRFGYRFISLVWSPVLIVIIHFHNQYLPHSPIYNNQLAITSS
SYLVFSFIIAYMAMLATQQRIFYARMRRMAFMDPVVRLPNIRALSRALNKSSWSVLCFLR
IPELEILGRHYGVLLRIQYKQLLAESLSELLQSGEDIYQMAGHELVVHLNSEEHQQRIPL
LYEHLKKFRFVWNGMPLQPPVGFSYCNVRSPVIHLHLLLGELSSAADLSLATGSPENLQR
RGAINTQQELKDKVTIMNQLVKALEQDRFMLMAQPIVGIRGDSYHEVLLRMLNDDDEVIM
PDTFLPVAHEFGLSARIDSWVLEHTLIFMDKRRKKLPGMRLAINISPFSVSNSHFHQQVK
TLLEHYDIEPWQIIFELTENHSLTNPEQARKTLAQLQDLGCRVAIDDFGTGYASYARLKT
MNADLLKIDGSFIRNLVTSSLDYQAVASICLLARMKNMQVVAEYVETPEIRQAVVSLGID
YMQGYDIGKPAPLEALVEDE