Protein Info for BWI76_RS20995 in Klebsiella michiganensis M5al

Annotation: RNA degradosome polyphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 PF13089: PP_kinase_N" amino acids 7 to 109 (103 residues), 103.8 bits, see alignment E=1.6e-33 TIGR03705: polyphosphate kinase 1" amino acids 7 to 677 (671 residues), 860.7 bits, see alignment E=4.1e-263 PF02503: PP_kinase" amino acids 119 to 303 (185 residues), 154.5 bits, see alignment E=6.1e-49 PF17941: PP_kinase_C_1" amino acids 331 to 493 (163 residues), 247 bits, see alignment E=1.9e-77 PF13091: PLDc_2" amino acids 367 to 487 (121 residues), 36.2 bits, see alignment E=1.2e-12 PF13090: PP_kinase_C" amino acids 501 to 672 (172 residues), 221.3 bits, see alignment E=1.5e-69

Best Hits

Swiss-Prot: 93% identical to PPK1_SALTY: Polyphosphate kinase (ppk) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_00620)

MetaCyc: 93% identical to polyphosphate kinase (Escherichia coli K-12 substr. MG1655)
Polyphosphate kinase. [EC: 2.7.4.1]

Predicted SEED Role

"Polyphosphate kinase (EC 2.7.4.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism or Purine conversions (EC 2.7.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7P8 at UniProt or InterPro

Protein Sequence (686 amino acids)

>BWI76_RS20995 RNA degradosome polyphosphate kinase (Klebsiella michiganensis M5al)
MGQEKLYIEKELSWLSFNERVLQEAADKSNPLIERMRFLGIYSNNLDEFYKVRFAELKRR
IIISEEQGSTAHSRHLLGKIQARVLKADQEFDGLYNELLLEMARNQIFLINERQLSVNQQ
SWLRNYFKLYLRQHITPILINRETDLVQFLKDDYTYLAVEIIRGDTINYALLEIPSDKVP
RFVNLPPEAPRRRKPMILLDNILRYCLDDIFKGFFDYDALNAYSMKMTRDAEYDLVHEME
SSLMELMSSSLKQRLTAEPVRFVYQRDMPDAMVEMLRDKLSISNYDSMLPGGRYHNFKDF
IGFPNVGKANLVNKPMPRLRHLWFDKFRNGFDAIRERDVLLYYPYHTFEHVLELLRQASF
DPSVLAIKINIYRVAKDSRIIDSMIHAAHNGKKVTVVVELQARFDEEANIHWAKRLTEAG
VHVIFSAPGLKIHAKLFLVSRKEGDEVVRYAHIGTGNFNEKTARLYTDYSLLTADARITN
EVRRVFNFIENPYRPVSFDYLLVSPQNSRRLLYEMIDREIANAQNGQPSGIMLKLNNLVD
KGLVDRLYAASSSGVPVNLLIRGMCSLIPGLEGISENIRVTSIVDRFLEHDRVYCFENGG
DKQVWLSSADWMTRNIDYRIEVAAPLLDPRLKQRVLDIFDLLFNDTVKARYLDKELSNRY
VPRGNRRKVRAQMAIYDYLKSLEQPD