Protein Info for BWI76_RS20980 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 365 to 382 (18 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details PF13347: MFS_2" amino acids 8 to 420 (413 residues), 218 bits, see alignment E=1.8e-68 PF07690: MFS_1" amino acids 10 to 363 (354 residues), 39.8 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_00605)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7H3 at UniProt or InterPro

Protein Sequence (484 amino acids)

>BWI76_RS20980 MFS transporter (Klebsiella michiganensis M5al)
MGDIFGSGAMTITGLWLLYFYIEVAGLSPAAAASIFAIAKIWDGITDPIMGYITDNIRTR
WGRRRLFFIIGAPLSFCFALMWVSGFGYAWYLGTYLLFSTVFTLLMVPYDTLPAEMTSRY
DLRSKMSGARMLFAQATAFLSALIPGQILAHVADKSQAFLYIGLVFSVLFALPWIFVWRG
TWERENLPPPSAQRGMGKTLISLYREMASTFRLRTFRIHIMMYVGGAVALDIFGSLFMHY
LTYVLQVGASLASQAMSLMTLFQFFAIPFFTWLCIRIGNGNAYKLAIGLIMCALLWFSQL
SASISHLSWLLLGGAIVMGIARGGTYLIPWNVYNFLPDVDEAYTGVRREGIYAGVMMLTR
KFSQALALFIVGLALEAFGFTKGAESQDAAALNGIWWVFLIGPGLLTLLAMYGAFRFRLS
QECHQTLTCELERLRSGGKPEDASTQVRQTVELLTGHPHMNTHWQHIAETTTQGNHYVAE
NKPS