Protein Info for BWI76_RS20945 in Klebsiella michiganensis M5al

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 3 to 208 (206 residues), 300.2 bits, E=3.8e-94
• PF14681: UPRTase
  • amino acids 7 to 207 (201 residues), 232.8 bits, E=3e-73
• PF00156: Pribosyltran
  • amino acids 63 to 169 (107 residues), 52.9 bits, E=2.6e-18

Best Hits

Swiss-Prot: 98% identical to UPP_ENT38: Uracil phosphoribosyltransferase (upp) from Enterobacter sp. (strain 638)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 96% identity to ecj:JW2483)

MetaCyc: 96% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (10/10 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A0A285B7N7 at UniProt or InterPro

Protein Sequence (208 amino acids)

>BWI76_RS20945 uracil phosphoribosyltransferase (Klebsiella michiganensis M5al)
MKIVEVKHPLVKHKLGLMREHDISTKRFRELASEVGSLLTYEATSDLATEKVTIEGWNGP
VEIEQIKGKKITVVPILRAGLGMMEGVLEHVPSARISVVGIYRNEETLEPVPYFQKLVSN
IDERMALVVDPMLATGGSMIATIDLLKKAGCSSIKVLVLVAAPEGIAALEKAHPDVELYT
ASIDQGLNEHGYIIPGLGDAGDKIFGTK