Protein Info for BWI76_RS20935 in Klebsiella michiganensis M5al

Annotation: DnaA regulatory inactivator Hda

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR03420: DnaA regulatory inactivator Hda" amino acids 14 to 240 (227 residues), 278.9 bits, see alignment E=1.5e-87 PF00308: Bac_DnaA" amino acids 24 to 219 (196 residues), 62.7 bits, see alignment E=2.5e-21

Best Hits

Swiss-Prot: 95% identical to HDA_SALAR: DnaA regulatory inactivator Hda (hda) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K10763, DnaA-homolog protein (inferred from 95% identity to ecw:EcE24377A_2779)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B797 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS20935 DnaA regulatory inactivator Hda (Klebsiella michiganensis M5al)
MQAYVEVHLNAPAQLSLPLYLPDDETFASFWPGDNPSLLAALQNVLRQDHSGYIYIWSRE
GAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEQLSLVCIDNIECVAGDEL
WEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQ
ALQLRARLRGFEMPEDVCRFLLKRLDREMRSLFMTLDQLDRASITAQRKLTIPFVKEILK
L