Protein Info for BWI76_RS20930 in Klebsiella michiganensis M5al

Annotation: arsenate reductase (glutaredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 5 to 117 (113 residues), 162.6 bits, E=2.2e-52
• PF03960: ArsC
  • amino acids 8 to 117 (110 residues), 84.7 bits, E=2.1e-28

Best Hits

Swiss-Prot: 80% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_00555)

MetaCyc: 43% identical to arsenate reductase (glutathione/glutaredoxin) (Sinorhizobium meliloti)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenic detoxification (bacteria) (4/4 steps found)
• arsenic detoxification (plants) (5/6 steps found)
• arsenate detoxification III (2/2 steps found)
• arsenate detoxification I (4/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See A0A285B7Y1 at UniProt or InterPro

Protein Sequence (119 amino acids)

>BWI76_RS20930 arsenate reductase (glutaredoxin) (Klebsiella michiganensis M5al)
MSDTVKIYHNPRCSKSRDTLSLLKANGIDPEVVLYLETPPDAATLRQLLKMLGMASARDL
MRQKEDLYKSLDLANPQLSEEALIQAMIDNPKLIERPIVVSHGEARIGRPPEQVLEIVN