Protein Info for BWI76_RS20895 in Klebsiella michiganensis M5al
Annotation: phosphoribosylaminoimidazolesuccinocarboxamide synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to PUR7_KLEP3: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 95% identity to eco:b2476)MetaCyc: 95% identical to phosphoribosylaminoimidazole-succinocarboxamide synthase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]
Predicted SEED Role
"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- inosine-5'-phosphate biosynthesis I (6/6 steps found)
- inosine-5'-phosphate biosynthesis II (5/5 steps found)
- inosine-5'-phosphate biosynthesis III (5/6 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 6.3.2.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B7I5 at UniProt or InterPro
Protein Sequence (237 amino acids)
>BWI76_RS20895 phosphoribosylaminoimidazolesuccinocarboxamide synthase (Klebsiella michiganensis M5al) MQKQAELYRGKAKTVYSTENPDLLILEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK LAEAGIPTQMEALLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL FLKNDAMHDPMVNESYCETFGWVSKENLARMQELTFKANDVLKKLFDDAGLILVDFKLEF GLFKGEVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSLGGLIEAYEEVAHRLGVKLD