Protein Info for BWI76_RS20885 in Klebsiella michiganensis M5al

Annotation: tRNA(Met) cytidine acetyltransferase TmcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05127: Helicase_RecD
  • amino acids 194 to 334 (141 residues), 138.9 bits, E=6e-44
• PF13718: GNAT_acetyltr_2
  • amino acids 366 to 475 (110 residues), 41 bits, E=5.2e-14
  • amino acids 482 to 530 (49 residues), 30.3 bits, 9.7e-11
• PF00583: Acetyltransf_1
  • amino acids 389 to 506 (118 residues), 24.8 bits, E=8.1e-09
• PF13673: Acetyltransf_10
  • amino acids 452 to 527 (76 residues), 24.8 bits, E=6.6e-09
• PF13508: Acetyltransf_7
  • amino acids 453 to 507 (55 residues), 27.9 bits, 8.8e-10
• PF17176: tRNA_bind_3
  • amino acids 534 to 649 (116 residues), 133.8 bits, E=1.4e-42

Best Hits

Swiss-Prot: 64% identical to TMCA_CITK8: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 73% identity to kva:Kvar_1247)

MetaCyc: 64% identical to tRNAMet cytidine acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5418 [EC: 2.3.1.193]

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.193

Sequence Analysis Tools

See A0A285B7X3 at UniProt or InterPro

Protein Sequence (666 amino acids)

>BWI76_RS20885 tRNA(Met) cytidine acetyltransferase TmcA (Klebsiella michiganensis M5al)
MDELRHLTAQMAREGIRRLLVLSGDDAWTLRQAQTVRTELASDGLWVGPRPMPEPYASPA
ALKSLLGREFQHAFFDAREGFDVAAFAALAGTLRAGSWLVLLTPDFAQWPARPDADSLRW
SDAPDPISTPNFVYRFCQQSSADNASILWRQGEECVVPAFAARPRWRPADGHPLAEQAAV
LAELSGSPPGIAALTAERGRGKSALAGMLIRQLAGDAIVTAPARAATEVMAAFAGEAFRF
MAPDALLASDCTAGWLIVDEAAAIPGPLLRQLVSRFPRTLLTTTVQGYEGTGRGFLLKFC
ASFAHLRQFSLTAPIRWASGCPLEAAIARLLLFNDETFQHAPGGDIALESVSQQSWRRQP
ALPEAMYQLLSGAHYRTSPLDLRRMMDAPGQHFTCARSGNRIAGALWLVEEGGLEPSLSQ
AVWAGYRRPRGNLVAQSLAAHGGSPLAATLTGLRISRIAVHPARQREGLGQRLVAQAASQ
GAERDYLSVSFGYTPELWRFWQRCGFTLVRLGTHREASSGCYTAMALYPLSEAGQRLASE
ESARLLRDEFWLRDWRDEPSPLPERKATILSEEDWLEVAGFAFAHRPLLTSAGSLNRLLI
RVDLPLPALRARLQQQDETTVCRTLGLSGRKALLVRLREEAAQALSGVNADRANDLRQQV
QMLQFF