Protein Info for BWI76_RS20845 in Klebsiella michiganensis M5al

Annotation: GDP-mannose pyrophosphatase NudK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 7 to 186 (180 residues), 233.5 bits, E=7.3e-74
• PF00293: NUDIX
  • amino acids 45 to 163 (119 residues), 45.2 bits, E=4.9e-16

Best Hits

Swiss-Prot: 85% identical to NUDK_KLEP7: GDP-mannose pyrophosphatase NudK (nudK) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K12945, GDP-mannose pyrophosphatase NudK [EC: 3.6.1.-] (inferred from 85% identity to kpu:KP1_4052)

MetaCyc: 76% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"GDP-mannose pyrophosphatase YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See A0A285B7L6 at UniProt or InterPro

Protein Sequence (194 amino acids)

>BWI76_RS20845 GDP-mannose pyrophosphatase NudK (Klebsiella michiganensis M5al)
MSLNINVIKDKILSENWFVLRNMTYELTRSDGSVVRHRREVYDRGNGATILLYNRHKQTV
VLVRQFRIATWINGNEDGMLIETCAGLLDSDEPEECVRKEAIEETGFEVGEVRKLFELFM
SPGGVTELIYFFIAEYDDTQRANDGGGVDDEDIEVLELPYHRALEMMANGEIRDGKAVIL
LQYLQTSGLMNGDL