Protein Info for BWI76_RS20805 in Klebsiella michiganensis M5al

Annotation: phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF01515: PTA_PTB" amino acids 2 to 320 (319 residues), 397.3 bits, see alignment E=2.9e-123 TIGR00651: phosphate acetyltransferase" amino acids 17 to 319 (303 residues), 322.1 bits, see alignment E=2e-100

Best Hits

Swiss-Prot: 86% identical to EUTD_SALTY: Ethanolamine utilization protein EutD (eutD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04020, phosphotransacetylase (inferred from 87% identity to sea:SeAg_B2611)

MetaCyc: 85% identical to phosphate acetyltransferase EutD (Escherichia coli K-12 substr. MG1655)
Phosphate acetyltransferase. [EC: 2.3.1.8]

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8), ethanolamine utilization-specific" in subsystem Ethanolamine utilization (EC 2.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7L0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BWI76_RS20805 phosphate acetyltransferase (Klebsiella michiganensis M5al)
MIIERARQLALRSPARVVFADALDIRVLKAAHYLQQQRLAKPILIASPFALRQFALNHRL
PMDGMQIVDPLSNRQIRAAFARRWLDRAGEKTPPDAEEKLNDPLMFAAAMVGAGQADVCI
AGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYAGPALGFADCSVVPQPTAAQLAD
IAIASAETWQAITGEEPRVAMLSFSSNGSARHPNVANVQQATGIVRQRAPQLMVDGELQF
DAAFVPEVAAQKAPASPLQGRANVMVFPSLEAGNIGYKIAQRLGGYRAVGPLIQGLAAPL
HDLSRGCSVQEIIELALVAAVPRQTDASRVNRSQTRVV