Protein Info for BWI76_RS20780 in Klebsiella michiganensis M5al

Annotation: alcohol dehydrogenase EutG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 233 to 241 (9 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details PF00465: Fe-ADH" amino acids 27 to 387 (361 residues), 385.7 bits, see alignment E=2e-119 PF13685: Fe-ADH_2" amino acids 35 to 128 (94 residues), 35 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 91% identical to EUTG_SALTY: Ethanolamine utilization protein EutG (eutG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04022, alcohol dehydrogenase (inferred from 91% identity to set:SEN2441)

Predicted SEED Role

"Ethanolamine utilization protein EutG" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7V1 at UniProt or InterPro

Protein Sequence (395 amino acids)

>BWI76_RS20780 alcohol dehydrogenase EutG (Klebsiella michiganensis M5al)
MQAELQTALFQAFDTLNLQRVKTFSVPPVTLCGLGALSACGQEAQARGVNHLFVMVDSFL
HQAGLTAGLARSLAVKGVAMTVWPCPPGEPCVTDVCAAVAQLREAKCDGVVAFGGGSVLD
AAKAVALLVTNPEQTLSEMTESSVLRPRLPLIAVPTTAGTGSETTNVTVIIDAVSGRKQV
LAHASLMPDVAILDAALTEGVPPQVTAMTGIDALTHAVEAYSALNATPFTDSLALGAIAM
IGQALPKAVGYGHDLAARESMLLASCMAGMAFSSAGLGLCHAMAHQPGAALHIPHGQANA
MLLPTVMAFNRMVCRERFRQIGRALIAKKTDDHEAIAAVEALIAEVGLSKRLSDAGAKPE
HFSAWAQAAQEDICLRANPRTATREQIIDLYAAAH