Protein Info for BWI76_RS20630 in Klebsiella michiganensis M5al

Annotation: cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 4 to 323 (320 residues), 327.3 bits, see alignment E=6.9e-102 PF04354: ZipA_C" amino acids 196 to 322 (127 residues), 163 bits, see alignment E=1.6e-52

Best Hits

Swiss-Prot: 79% identical to ZIPA_KLEP7: Cell division protein ZipA (zipA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03528, cell division protein ZipA (inferred from 79% identity to kpu:KP1_4006)

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B739 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BWI76_RS20630 cell division protein ZipA (Klebsiella michiganensis M5al)
MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSRDDEESESDDFNDD
VEGVGEVRVHRASHAPNGVHGEHEAPRQPQHQYQPPYERQAQQPPVRPEEPVRAAQPPQQ
QPVRPQAPVQQPHHAVPPQQPVMQPVQPPQPQQPVQHVQQPVQQPAIAPELQPTPEPQAP
EPQQAAPQPKERKETVIVMNVAAHHGSQLNGELLINSIQQAGFKFGDMNIFHRHLSPDGS
GQVLFSLANMVKPGTFNPDSMADMMTPGVTIFMQVPSFGDELQNFKLMLQSAQYIADEVG
GVVLDDQRRMMTPQKLREYQDRIREVKEANA