Protein Info for BWI76_RS20570 in Klebsiella michiganensis M5al

Annotation: glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR00464: glutamate--tRNA ligase" amino acids 2 to 463 (462 residues), 692.7 bits, see alignment E=1.4e-212 PF00749: tRNA-synt_1c" amino acids 2 to 305 (304 residues), 405.7 bits, see alignment E=1.1e-125 PF19269: Anticodon_2" amino acids 324 to 461 (138 residues), 122.2 bits, see alignment E=2.3e-39

Best Hits

Swiss-Prot: 96% identical to SYE_CITK8: Glutamate--tRNA ligase (gltX) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 96% identity to cko:CKO_00396)

MetaCyc: 95% identical to glutamate--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Glutamate--tRNA ligase. [EC: 6.1.1.17]

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7G5 at UniProt or InterPro

Protein Sequence (472 amino acids)

>BWI76_RS20570 glutamate--tRNA ligase (Klebsiella michiganensis M5al)
MKIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLSLEWDEGPYFQTKRFDRYNAVIDEMLQAGTAYKCYCSKERLEALREEQMAKGEKPR
YDGRCRHGHEHHADDEPCVVRFANPEEGSVVFDDQIRGPIEFSNHELDDLIIRRTDGSPT
YNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVSMINGDDGKKLSK
RHGAVSVMQYRDDGYLPEALLNYLVRLGWSSGDQEIFSREEMIKLFSLGAVSKSASAFNT
EKLQWLNHHYINSLAPEYVATHLQWHIEQENIDTRNGPQLADLVKLLGERCKTLKEMAAS
CRYFYEDFAEFDADAAKKHLRPVARQPLEMVRDKLAAMSDWTAENVHHAIQATADELEVG
MGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSVERINKALAFIAERESQQS