Protein Info for BWI76_RS20545 in Klebsiella michiganensis M5al

Annotation: sensor domain-containing phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 77 (37 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 160 to 185 (26 residues), see Phobius details amino acids 212 to 228 (17 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF05231: MASE1" amino acids 13 to 307 (295 residues), 128 bits, see alignment E=4.1e-41 PF00563: EAL" amino acids 492 to 718 (227 residues), 204.6 bits, see alignment E=1.5e-64

Best Hits

KEGG orthology group: None (inferred from 74% identity to kpe:KPK_1394)

Predicted SEED Role

"FIG00732589: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B796 at UniProt or InterPro

Protein Sequence (726 amino acids)

>BWI76_RS20545 sensor domain-containing phosphodiesterase (Klebsiella michiganensis M5al)
MIDHLNIKIKKTLLAFLVCLIAIPLSRFISPQTIIDGNQIYLAWLPLSLMYSVLFIFGRY
AVAPLIIAFAITNAWIIDLTLAQALILLFCQLFSVFVSCAIVRFQLGRRWRAGLTAKHMG
ARIFWGGFFAPLLLKVTMYMAGRFFSFPLAISSYFGNMSVIYTIIDIQSLISAALIFTTF
FYYPLRMIISPHYARAFWRNLCHAWRTREQRVFTLYWFVALAAILLVLCTPYDSVFIAGY
LVPLIFILYFIGISRLGHTQIRISWSVSAFLLVAYNQNFLHGVQTEYSLSFVLSVLICFT
ICLFYMADIYARSERMKLRWRDQAEEDPLTGLPNLRALESHLQRNPAVAISSLRIQNLDF
LSRHYGMMMRVESKRQIARKLQPLLAQGERIYQLPGSELLLVLNGPEPEARLNHIVSTLN
HKKFSWNNQALDLEFGASWGGYGGKESELHPMLGQLSWLSEQAGAGRRVLALDAAQEQIS
DQTSEQVRLLAKIKQALSERGVVLYAQPIRNACGEGYYEILSRMRCGNTIITPDRFIPLI
AQFNLSQRFDMQVLETLFSSLKNHHGRHFSVNLLPYTLMQKDSAAQIIALFKRHNLSAEA
ITIEVTEEQAFSDVETSMHNIQLLRDFGCGIAIDDFGTGYANYERLKSLQADILKIDGCF
VRDIETDPLDAIMVKSIIEMAKVKKMKVVAEYVETPEQREKLLELGVDYLQGYLIGKPLP
LSELRT