Protein Info for BWI76_RS20525 in Klebsiella michiganensis M5al

Annotation: glyceraldehyde 3-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 28 to 328 (301 residues), 242.1 bits, E=3.4e-76

Best Hits

Swiss-Prot: 61% identical to GPR_ECO57: L-glyceraldehyde 3-phosphate reductase (gpr) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 88% identity to eae:EAE_00280)

MetaCyc: 60% identical to L-glyceraldehyde 3-phosphate reductase (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]; 1.1.1.- [EC: 1.1.1.21]

Predicted SEED Role

"Putative ion-channel protein"

MetaCyc Pathways

• methylglyoxal degradation III (2/2 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)
• D-arabinose degradation V (1/3 steps found)
• detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
• superpathway of pentose and pentitol degradation (21/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycerolipid metabolism
• Pentose and glucuronate interconversions
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Sequence Analysis Tools

See A0A285B7G1 at UniProt or InterPro

Protein Sequence (330 amino acids)

>BWI76_RS20525 glyceraldehyde 3-phosphate reductase (Klebsiella michiganensis M5al)
MVYQANATRYQTMEYRRCGHSGLKLPAVSLGLWHNFGDETRVETSRQLLRHAFDLGITHF
DLANNYGPPPGSAESNFGRILKEDFLPYRDELIISSKAGYTMWDGPYGDWGSRKYLIASL
DQSLKRMGLDYIDIFYHHRPDPETPLLETMRALDHIVRQGKALYVGLSNYPLEQARQAVN
ILNDLGTPCLIHQPKYSMFERWVEEGLLDFLHTSGVGSIAFSPLAGGQLTNRYLHGIPAD
SRAASGSRFLQPDQLTESKLEKVRQLDALAESRGQKLSQMALAWVLRDEKVTSVLIGASK
TSQLDDAVGMLENRHFSAEERATIDAILAV