Protein Info for BWI76_RS20515 in Klebsiella michiganensis M5al

Annotation: ion channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 345 to 363 (19 residues), see Phobius details amino acids 370 to 399 (30 residues), see Phobius details PF00654: Voltage_CLC" amino acids 69 to 391 (323 residues), 66.6 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 78% identical to YFEO_SALPK: Putative ion-transport protein YfeO (yfeO) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: None (inferred from 85% identity to kpu:KP1_3991)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7F5 at UniProt or InterPro

Protein Sequence (411 amino acids)

>BWI76_RS20515 ion channel protein (Klebsiella michiganensis M5al)
MLHPRARTMLLLSIPAIVIGIAASLVLIVAMKTAAMLQKILWSNLPGALGMNASGPFWTI
AILTCTGIAVGLVVRFSPGHAGPDPATESLIGAPVSPSALPGLLAALIIGLAGGVSLGPE
HPIMVINIALTVALGSRIFPRVSALDWTILASSGTIGALFGTPVAAALIFSQTLNSSNDV
PLWDRLFAPLLAAAAGSLTTGLFFHPNFSLPIAQYNQWQLVDIFSGAIVTLIAIAVGMVG
VWCLPRLHALMQRLKNPILTLGIGGFLLGILGVIGGHITLFKGLEEMQQLAFSQTLTASD
FMLIALVKMAALVLAAACGFRGGRIFPAVFVGVALGLMLHAHVDAVPAAITVSCAILGLT
LVVTRDGWLSLFMAAVVVPDSTLLPLLCIVMLPAWLLLAGKPLMIAKRPND