Protein Info for BWI76_RS20470 in Klebsiella michiganensis M5al

Annotation: long-chain fatty acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03349: Toluene_X" amino acids 16 to 454 (439 residues), 514.3 bits, see alignment E=1e-158

Best Hits

Swiss-Prot: 75% identical to FADL_ECO57: Long-chain fatty acid transport protein (fadL) from Escherichia coli O157:H7

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 83% identity to esa:ESA_00879)

MetaCyc: 75% identical to long-chain fatty acid outer membrane channel / bacteriophage T2 receptor (Escherichia coli K-12 substr. MG1655)
RXN0-1802

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B730 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BWI76_RS20470 long-chain fatty acid transporter (Klebsiella michiganensis M5al)
MSQKTRLTQSALAVAVAMVSTQAWSAGFQLNEFSSSGLGRAYSGEGAIADDAGNASRNPA
LIMMFDRPTFSGGAIFVDPDVNVTGSSVIGNDASQDNIAPTAWVPNLHFVAPINDQFGWG
ASLTSNYGLATEFNNDFAAGSMGGTTDLETLNLNLSGAYRLNDHWSFGLGFDAVYARAKL
ERYAGDLPDIIGAQLPGMVKAGKLSPAQAAAIGQQAGGISRDTQIARLKGDEWGFGWNAG
ILYEVDKNNRYGLTYRSEIKVDFDGDYKSSLPSSLNPINSALGLGLPYGTGGSTIGGSLT
LNLPEMWEISGYNRVAPKWAVHYSLAYTSWSQFQELKATKTSGGETLFYKDEGFKDSYRI
ALGTTYYHDDNWTFRTGIAFDDSPVPASNRSISIPDQDRLWLSAGTTYAFNKDASVDVGV
SYMHGQHVEFTEGPYTFKSEGKAWLYGANFNYRF