Protein Info for BWI76_RS20440 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L3 N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 13 to 295 (283 residues), 455.2 bits, see alignment E=8.8e-141 TIGR00536: methyltransferase, HemK family" amino acids 15 to 304 (290 residues), 348.1 bits, see alignment E=3.2e-108 PF05175: MTS" amino acids 133 to 215 (83 residues), 55.8 bits, see alignment E=1.1e-18 PF06325: PrmA" amino acids 134 to 207 (74 residues), 24.9 bits, see alignment E=3.5e-09 PF09445: Methyltransf_15" amino acids 135 to 209 (75 residues), 28.3 bits, see alignment E=3e-10 PF13847: Methyltransf_31" amino acids 135 to 208 (74 residues), 28.9 bits, see alignment E=2.3e-10 PF13649: Methyltransf_25" amino acids 136 to 216 (81 residues), 35.4 bits, see alignment E=3.6e-12

Best Hits

Swiss-Prot: 91% identical to PRMB_SALTY: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 91% identity to ecq:ECED1_2794)

MetaCyc: 91% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B791 at UniProt or InterPro

Protein Sequence (310 amino acids)

>BWI76_RS20440 50S ribosomal protein L3 N(5)-glutamine methyltransferase (Klebsiella michiganensis M5al)
MDKIFVDEAVNELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEAVQLVMPSLYLPLDIP
VDMRTARLTSSEKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGEL
INNHFSGLIDHYPQHILDMCTGSGCIAIACAYAFPEAEVDAVDISLDALAVTEQNVEDHG
LIHNVTPIRSDLFRDLPKVQYDLIVTNPPYVDEEDMSDLPGEYRHEPVLGLASGSDGLKL
TRRILACAPDYLSDDGILICEVGNSMVHLMEQYPDVPFTWLEFENGGDGVFMLTKPQLIA
ARAHFGIYKD