Protein Info for BWI76_RS20400 in Klebsiella michiganensis M5al

Annotation: arabinose transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 242 (222 residues), 64.3 bits, see alignment E=5.1e-22 amino acids 223 to 387 (165 residues), 64.5 bits, see alignment E=4.4e-22

Best Hits

Swiss-Prot: 83% identical to YFCJ_SALAR: Uncharacterized MFS-type transporter YfcJ (yfcJ) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_24610)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B771 at UniProt or InterPro

Protein Sequence (391 amino acids)

>BWI76_RS20400 arabinose transporter (Klebsiella michiganensis M5al)
MSAVTETKHTPSANGSLFRITFAVFLTYMTVGLPLPVIPLFVHQELGFGNTMVGIAVGIQ
FLATVLTRGYAGRLADQYGAKRSVLQGMLACALAGGAWLCAALLPVPVMAKFGLLVLGRL
ILGFGESQLLTGNLSWGMGLVGPMRSGKVMSWNGMAIYGSLAAGAPLGLLIYSHYGVAAL
ACVTMVLPLVAWAINGTVRKIPAHGGERPSLWSVVGMIWRPGIGLGLQGVGFAVIGTFVS
LYFASNGWAMAGFTLTAFGGAFVLMRVLFGWMPDRFGGVKVAIVSLLIEAIGLALLWQAP
DAWIALAGAALTGCGCSLIFPALGVEVVKRVPPQVRGTALGGYAAFQDISYGVTGPLTGL
LATSLGYSSVFLAAAICAVLGILVTLVSLRK