Protein Info for BWI76_RS20395 in Klebsiella michiganensis M5al

Annotation: flagella biosynthesis regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 301 to 318 (18 residues), see Phobius details

Best Hits

Swiss-Prot: 65% identical to FLK_SALTY: Flagellar regulator flk (flk) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 75% identity to kva:Kvar_1343)

Predicted SEED Role

"Cell division protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B703 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BWI76_RS20395 flagella biosynthesis regulator (Klebsiella michiganensis M5al)
MTQPVSGMSERPPGSGEPPLTTQQRTALERLITRLVALTSQQNAEVWACVKHDLSLKNDA
PLLASHFAAAEHSLNQRLILAQQNHHRRQILAQLSELLNQGNNRQAVSDYIRQHDGQTAL
HALTQPQLENVLQLLQSGQLSIPQPQQRPPTHRPLLPAEHNTLNQQVTKLAAATGESSKL
IWQSMLELSGVKSGELIPATHFTPLSYWLHARQTLSSQAAPTLTSLQAALKQPLEAAEWQ
RVMDFAQTHWHATAQTPLSAAQLLTLLNKIFVLRVARAQETLAIPPVQAPSASPWLALKK
PWVIALAAIVALGLLWLVI