Protein Info for BWI76_RS20370 in Klebsiella michiganensis M5al

Annotation: acetyl-CoA carboxylase carboxyl transferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 22 to 302 (281 residues), 502 bits, E=2.4e-155
• PF17848: zf-ACC
  • amino acids 45 to 70 (26 residues), 50.8 bits, see alignment (E = 1.4e-17)
• PF01039: Carboxyl_trans
  • amino acids 110 to 305 (196 residues), 65.8 bits, E=3.2e-22

Best Hits

Swiss-Prot: 98% identical to ACCD_CITK8: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 96% identity to kpu:KP1_3954)

MetaCyc: 97% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• 2-oxobutanoate degradation I (2/4 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)
• methylaspartate cycle (12/19 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See A0A285B7C8 at UniProt or InterPro

Protein Sequence (325 amino acids)

>BWI76_RS20370 acetyl-CoA carboxylase carboxyl transferase subunit beta (Klebsiella michiganensis M5al)
MALCAPCDKTGIDQVQVERLSMSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAEL
ERNLEVCPKCDHHMRMSARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQ
KETGEKDALVVMKGTLHDMPVVAAAFEFSFMGGSMGSVVGARFVRAVEQALEDNCPLICF
SASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIA
EPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMN
LPAPNPEPAHEGEVVPPVPDQEPEA