Protein Info for BWI76_RS20260 in Klebsiella michiganensis M5al

Annotation: PTS mannitol transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02302: PTS_IIB" amino acids 2 to 83 (82 residues), 63.7 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K02822, PTS system, ascorbate-specific IIB component [EC: 2.7.1.69] (inferred from 92% identity to cro:ROD_27041)

Predicted SEED Role

"Putative sugar phosphotransferase component II B"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6X8 at UniProt or InterPro

Protein Sequence (90 amino acids)

>BWI76_RS20260 PTS mannitol transporter subunit IIB (Klebsiella michiganensis M5al)
MKIMAICGSGLGSSFMVEMNIKKVLKKLDIEAEVEHSDLSSATPGAADLFVMAKDIAASA
SVPESQLVVITNIIDINELEAQLRAWFARQ