Protein Info for BWI76_RS20260 in Klebsiella michiganensis M5al

Annotation: PTS mannitol transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02302: PTS_IIB
  • amino acids 2 to 83 (82 residues), 63.2 bits, E=1.5e-21

Best Hits

KEGG orthology group: K02822, PTS system, ascorbate-specific IIB component [EC: 2.7.1.69] (inferred from 92% identity to cro:ROD_27041)

Predicted SEED Role

"Putative sugar phosphotransferase component II B"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See A0A285B6X8 at UniProt or InterPro

Protein Sequence (90 amino acids)

>BWI76_RS20260 PTS mannitol transporter subunit IIB (Klebsiella michiganensis M5al)
MKIMAICGSGLGSSFMVEMNIKKVLKKLDIEAEVEHSDLSSATPGAADLFVMAKDIAASA
SVPESQLVVITNIIDINELEAQLRAWFARQ