Protein Info for BWI76_RS20255 in Klebsiella michiganensis M5al

Annotation: PTS ascorbate transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 422 to 445 (24 residues), see Phobius details PF03611: EIIC-GAT" amino acids 12 to 408 (397 residues), 498.3 bits, see alignment E=8.5e-154

Best Hits

KEGG orthology group: K03475, PTS system, ascorbate-specific IIC component (inferred from 96% identity to ent:Ent638_2844)

Predicted SEED Role

"FIG00732228: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7J9 at UniProt or InterPro

Protein Sequence (463 amino acids)

>BWI76_RS20255 PTS ascorbate transporter subunit IIC (Klebsiella michiganensis M5al)
MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKSFSDVVKGTIKTILGFIVLGGGATVL
VGSLNPLGGMFEHAFNIQGIIPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLK
YIFLTGHHTFYMACMIGVILTVAGFEGIGLVFTGSLILGLVMAFFPALAQRYMKRITGTD
DIAFGHFGTLGYVLSGWIGSVCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA
VSAGREYVESTFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVP
NARPALDCPVVYPYAPNAVLIGFLFSFLGGLVGLFLCGQFKWVLILPGVVPHFFTGATAG
VFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFANTTFSDADFGAVGIVLGNLA
RYLSPFAITGLVVALFVLLVVYNVFAKKRSAGGGAQENSGAKS