Protein Info for BWI76_RS20240 in Klebsiella michiganensis M5al

Annotation: phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 3 to 228 (226 residues), 135.8 bits, E=2.6e-43
• PF07085: DRTGG
  • amino acids 233 to 343 (111 residues), 89.6 bits, E=1.6e-29
• PF01515: PTA_PTB
  • amino acids 391 to 706 (316 residues), 432.8 bits, E=1.4e-133
• TIGR00651: phosphate acetyltransferase
  • amino acids 406 to 706 (301 residues), 456.3 bits, E=2.9e-141

Best Hits

Swiss-Prot: 97% identical to PTA_SALTY: Phosphate acetyltransferase (pta) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13788, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 97% identity to enc:ECL_03641)

MetaCyc: 95% identical to phosphate acetyltransferase (Escherichia coli K-12 substr. MG1655)
Phosphate acetyltransferase. [EC: 2.3.1.8]; PTAALT-RXN [EC: 2.3.1.8, 2.3.1.222]

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of L-threonine metabolism (18/18 steps found)
• mixed acid fermentation (16/16 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• L-threonine degradation I (6/6 steps found)
• (S)-propane-1,2-diol degradation (5/5 steps found)
• ethanolamine utilization (5/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (7/9 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• superpathway of taurine degradation (3/6 steps found)
• sulfolactate degradation II (1/4 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.222 or 2.3.1.8

Sequence Analysis Tools

See A0A285B747 at UniProt or InterPro

Protein Sequence (714 amino acids)

>BWI76_RS20240 phosphate acetyltransferase (Klebsiella michiganensis M5al)
MSRTIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRAGGDAPDQTTTIIRAN
SDLPAAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTQDAEVVLVEGLVPTRKHQFAQS
LNYEIAKTLNAEIVFVMSQGTDTPEQLKERIELTRSSFGGAKNTSITGVIVNKLNAPVDE
QGRTRPDLSEIFDDSSKAKVVKIDPAQLQDGSPLPVLGAVPWSFDLIATRAIDMAHHLNA
TIINEGDINTRRVKSVTFCARSIPHMLEHFRAGSLLVTSADRPDVLVAACLAAMNGVEIG
AILLTGAYEMDPRVSKLCERAFATGLPVFMVNTNTWQTSLSLQSFNLEVPVDDHERIEKV
QEYVANYINADWIESLTATSERSRRLSPPAFRYQLTELARKAGKRVVLPEGNEPRTVKAA
AICAERGIATCVLLGNPDEITRVAASQGVELGAGIEIVDPEVVRESYVARLVELRKSKGM
TEAVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVF
FMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSAIAFGIEPRVAMLSYSTGTSGAGSD
VEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVAKSKAPNSPVAGRATVFIFPDLNTGN
TTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQSSQQQA