Protein Info for BWI76_RS20215 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 95 to 124 (30 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 417 to 434 (18 residues), see Phobius details amino acids 440 to 456 (17 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details amino acids 506 to 536 (31 residues), see Phobius details amino acids 548 to 568 (21 residues), see Phobius details amino acids 588 to 608 (21 residues), see Phobius details PF03600: CitMHS" amino acids 16 to 555 (540 residues), 303.2 bits, see alignment E=4.8e-94 amino acids 511 to 607 (97 residues), 53.8 bits, see alignment E=3.6e-18 PF02080: TrkA_C" amino acids 232 to 297 (66 residues), 35.4 bits, see alignment E=1.6e-12 amino acids 326 to 394 (69 residues), 46.7 bits, see alignment E=4.9e-16 PF06808: DctM" amino acids 417 to 604 (188 residues), 35.6 bits, see alignment E=9.9e-13 PF00939: Na_sulph_symp" amino acids 439 to 604 (166 residues), 44.3 bits, see alignment E=2.7e-15

Best Hits

Swiss-Prot: 86% identical to YFBS_ECOLI: Uncharacterized transporter YfbS (yfbS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_24450)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B762 at UniProt or InterPro

Protein Sequence (610 amino acids)

>BWI76_RS20215 transcriptional regulator (Klebsiella michiganensis M5al)
MNGELIWVLSLLAVAVVLFATGKVRMDAIALLVIVAFVLSGTLTLSEAFSGFSDPNVILI
AALFIIGDGLVRTGVATKMGSWLVKVAGNSETKMLVYLMLTVAGLGAFMSSTGVVAIFIP
VVLSVSMRMNTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNSELLREGLQGFSFFSVTP
IGLVVLVLGVFYMLVMRFMLKGDEGEQVRDGRKRSTFRDLIKDYHLTGRARRLAIRPGSP
MIGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSASDVDLRQ
FCGEQMLEPMVLRGEYFSDQALDVGMAEVSLIPDSELIGKTVREIAFRTRFDLNIVGLKR
DGKALDGAVTDEALQLGDIMLVVGNWRQIALLAKRGRDFVVLNMPIEVNDASPAHSQAPH
AIFCLVLMVALMLTDEIPNPIAAIVACLLMGKFRCINAESAYKAIHWPSIILIVGMMPFA
LALQKTGGVDLVVQGLMDVAGSKGPYLMLGCLFVMCAAIGLFISNTATAVLMAPIALAAA
KSMGVSPYPFAMVVAMAASAAFMTPVSSPVNTLVLGPGKYSFSDFVKIGVPFTILVMVVC
VLLIPVLFPF