Protein Info for BWI76_RS20170 in Klebsiella michiganensis M5al

Annotation: NADH-quinone oxidoreductase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 13 to 423 (411 residues), 674.7 bits, see alignment E=1.7e-207 PF01512: Complex1_51K" amino acids 54 to 226 (173 residues), 169.9 bits, see alignment E=3.7e-54 PF10589: NADH_4Fe-4S" amino acids 339 to 421 (83 residues), 97.2 bits, see alignment E=4.1e-32

Best Hits

Swiss-Prot: 96% identical to NUOF_SALTY: NADH-quinone oxidoreductase subunit F (nuoF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to eae:EAE_24410)

MetaCyc: 95% identical to NADH:quinone oxidoreductase subunit F (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6X7 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BWI76_RS20170 NADH-quinone oxidoreductase subunit F (Klebsiella michiganensis M5al)
MKTIIRTAETHPLTWRLRDDKQPVWLDEYQSKNGYAGARKALSGMAPDEIVTAVKDAGLK
GRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISA
FALKAYRGYIFLRGEYIEAAQHLRRAIAEATEAGLLGKNILGTGFDFELFVHTGAGRYIC
GEETALINSLEGRRANPRSKPPFPASSGVWGKPTCVNNVETLCNVPAILANGVEWYQNIS
TSKDAGTKLMGFSGRVKNPGVWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFL
TEAHLDLPMEFESIGKAGSRLGTALAMAVDHEIGMVPLVRNLEEFFARESCGWCTPCRDG
LPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFREEFE
AGIKQQFSNTHAINGIQPNLLKTRW