Protein Info for BWI76_RS20045 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 72 (27 residues), see Phobius details amino acids 83 to 96 (14 residues), see Phobius details amino acids 110 to 136 (27 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 356 to 381 (26 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 465 to 489 (25 residues), see Phobius details PF01970: TctA" amino acids 20 to 440 (421 residues), 514.5 bits, see alignment E=9.2e-159

Best Hits

Swiss-Prot: 41% identical to YZ2R_AGRVI: Uncharacterized 52.8 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: None (inferred from 95% identity to eae:EAE_24315)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B705 at UniProt or InterPro

Protein Sequence (506 amino acids)

>BWI76_RS20045 hypothetical protein (Klebsiella michiganensis M5al)
MDIWIYLSQGFAVAMTPTNLLIALIGCFVGTIVGLLPGLGPINGVAILLPLAFALHLPAE
SALILLATVYIGCEYGGRISSILLNVPGDAAAIMTAIDGYPMAQQGRGGVALSISAVSSF
VGSMIAIGGMILFAPILAQWSLAFGPAEYFALMVFAIACLGSMMAQKPLKSFLAALIGLG
LATVGVDANTGVYRFTFDSVHLSDGVQFIVVVIGLFSVSEILLMLESTSGGQKLVRKTGR
MLFNAKEAGQCVGATLRSSVVGFFVGILPGAGATIASAITYMTEKKLSGNSDTFGKGDIR
GVAAPEAANNASACGSFIPMLTLGVPGSGTTAVMMGALTLYNITPGPAMFTEQPDIVWGL
IAALLIANVMLLIMNIPLIGLFTRMLTIPLWFLVPAIAAVSAVGVYAVHSTTFDLLLMVG
LGVLGYIMRKMHFPMSPLILGFVLGEMLEQNLRRALSISNGNVAILWQSGVTKTLLLLAI
AVIVVPPLLRYMRKRQQKTPGDIPSS