Protein Info for BWI76_RS20040 in Klebsiella michiganensis M5al

Annotation: tricarboxylic transport membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 24 (2 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 115 to 115 (1 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details PF07331: TctB" amino acids 5 to 137 (133 residues), 72.4 bits, see alignment E=2.2e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_24310)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6U0 at UniProt or InterPro

Protein Sequence (143 amino acids)

>BWI76_RS20040 tricarboxylic transport membrane protein (Klebsiella michiganensis M5al)
MSDRIFAGVWLLLCAGGMFIAWQIHSEYAYEPVGPRPFPVGIIGLMLLCSVLLLLRRPDA
ITWPGRLVLQRLLTMVVALVVYAWGFEWLGFPLATALLTAVFGLLFGATLPAAGVAGVAM
GIALWYVFDALLDVTLPLGVWLS