Protein Info for BWI76_RS19990 in Klebsiella michiganensis M5al

Annotation: L-rhamnonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF02746: MR_MLE_N" amino acids 66 to 157 (92 residues), 34.4 bits, see alignment E=2.3e-12 PF13378: MR_MLE_C" amino acids 179 to 392 (214 residues), 127.7 bits, see alignment E=5.6e-41

Best Hits

Swiss-Prot: 97% identical to RHMD_SALEP: L-rhamnonate dehydratase (rhmD) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K12661, L-rhamnonate dehydratase [EC: 4.2.1.90] (inferred from 97% identity to ecv:APECO1_4314)

MetaCyc: 96% identical to L-rhamnonate dehydratase (Escherichia coli K-12 substr. MG1655)
L-rhamnonate dehydratase. [EC: 4.2.1.90]

Predicted SEED Role

"L-rhamnonate dehydratase (EC 4.2.1.90)" in subsystem L-rhamnose utilization (EC 4.2.1.90)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B700 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BWI76_RS19990 L-rhamnonate dehydratase (Klebsiella michiganensis M5al)
MTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGANHWIDDHIATPMSKYKQYEQSRQSFGI
NVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQMLNATM
YYSGSGGLVMNTISCIDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLAKEMG
FIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLAHACA
PSNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLSETGIDIMQPDVG
WCGGLTTLVEIAAIAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTMRPQF
DPILVDEPVPVNGRIHKSVLDKPGFGVELNRDCNLKRPYSH