Protein Info for BWI76_RS19980 in Klebsiella michiganensis M5al

Annotation: 2-keto-3-deoxy-L-rhamnonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 19 to 244 (226 residues), 221.1 bits, E=5.6e-70

Best Hits

Swiss-Prot: 89% identical to RHMA_KLEP7: 2-keto-3-deoxy-L-rhamnonate aldolase (rhmA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K12660, 2-dehydro-3-deoxy-L-rhamnonate aldolase [EC: 4.1.2.-] (inferred from 89% identity to kva:Kvar_1403)

MetaCyc: 84% identical to 2-keto-3-deoxy-L-rhamnonate aldolase (Escherichia coli K-12 substr. MG1655)
RXN0-5433 [EC: 4.1.2.53]

Predicted SEED Role

"2-dehydro-3-deoxy-L-rhamnonate aldolase (EC 4.1.2.n3)" (EC 4.1.2.n3)

MetaCyc Pathways

• L-rhamnose degradation II (4/8 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-

Use Curated BLAST to search for 4.1.2.- or 4.1.2.53 or 4.1.2.n3

Sequence Analysis Tools

See A0A285B745 at UniProt or InterPro

Protein Sequence (267 amino acids)

>BWI76_RS19980 2-keto-3-deoxy-L-rhamnonate aldolase (Klebsiella michiganensis M5al)
MNAILSNPFKAGLLQGEAQIGLWLSSTSSYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQ
LQAIAPYVSQPVIRPVEGNRSLIKQVLDIGARTLLIPMVDTAEQAREIVSATRYPPVGTR
GVGAGVARAARWGRVENYMAQANDELCLLIQVESKTALDNLDAILEVEGIDGVFIGPADL
SASLGYPDNAGHPDVQRIIEQSIRRIRAAGKAAGFLAVDPEMAHKALAWGANFVAVGVDT
NLYTRALDKRLAMFKPIAEQAEGKGSY